| 1 |
|
|
| 2 |
|
|
| 3 |
|
|
| 4 |
|
|
| 5 |
|
|
| 6 |
|
|
| 7 |
|
|
| 8 |
|
|
| 9 |
|
|
| 10 |
|
|
| 11 |
|
|
| 12 |
|
|
| 13 |
|
|
| 14 |
|
|
| 15 |
|
|
| 16 |
|
|
| 17 |
|
|
| 18 |
|
|
| 19 |
|
|
| 20 |
|
|
| 21 |
|
package jalview.ws.sifts; |
| 22 |
|
|
| 23 |
|
import static org.testng.Assert.assertEquals; |
| 24 |
|
import static org.testng.Assert.assertTrue; |
| 25 |
|
|
| 26 |
|
|
| 27 |
|
import java.io.File; |
| 28 |
|
import java.io.IOException; |
| 29 |
|
import java.util.ArrayList; |
| 30 |
|
import java.util.HashMap; |
| 31 |
|
import java.util.Iterator; |
| 32 |
|
import java.util.Map; |
| 33 |
|
|
| 34 |
|
import org.testng.Assert; |
| 35 |
|
import org.testng.FileAssert; |
| 36 |
|
import org.testng.annotations.AfterTest; |
| 37 |
|
import org.testng.annotations.BeforeClass; |
| 38 |
|
import org.testng.annotations.BeforeTest; |
| 39 |
|
import org.testng.annotations.Test; |
| 40 |
|
|
| 41 |
|
import jalview.api.DBRefEntryI; |
| 42 |
|
import jalview.bin.Cache; |
| 43 |
|
import jalview.datamodel.DBRefEntry; |
| 44 |
|
import jalview.datamodel.DBRefSource; |
| 45 |
|
import jalview.datamodel.Sequence; |
| 46 |
|
import jalview.datamodel.SequenceI; |
| 47 |
|
import jalview.gui.JvOptionPane; |
| 48 |
|
import jalview.io.DataSourceType; |
| 49 |
|
import jalview.structure.StructureMapping; |
| 50 |
|
import jalview.xml.binding.sifts.Entry.Entity; |
| 51 |
|
import mc_view.Atom; |
| 52 |
|
import mc_view.PDBfile; |
| 53 |
|
|
| 54 |
|
@Test(enabled=false) |
| |
|
| 43.8% |
Uncovered Elements: 149 (265) |
Complexity: 31 |
Complexity Density: 0.13 |
|
| 55 |
|
public class SiftsClientTest |
| 56 |
|
{ |
| 57 |
|
|
| |
|
| 100% |
Uncovered Elements: 0 (2) |
Complexity: 1 |
Complexity Density: 0.5 |
|
| 58 |
1 |
@BeforeClass(alwaysRun = true)... |
| 59 |
|
public void setUpJvOptionPane() |
| 60 |
|
{ |
| 61 |
1 |
JvOptionPane.setInteractiveMode(false); |
| 62 |
1 |
JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION); |
| 63 |
|
} |
| 64 |
|
|
| 65 |
|
public static final String DEFAULT_SIFTS_DOWNLOAD_DIR = System |
| 66 |
|
.getProperty("user.home") |
| 67 |
|
+ File.separatorChar |
| 68 |
|
+ ".sifts_downloads" + File.separatorChar; |
| 69 |
|
|
| 70 |
|
|
| 71 |
|
private String testPDBId = "1a70"; |
| 72 |
|
|
| 73 |
|
private SiftsClient siftsClient = null; |
| 74 |
|
|
| 75 |
|
SequenceI testSeq = new Sequence( |
| 76 |
|
"P00221", |
| 77 |
|
"MAAT..TTTMMG..MATTFVPKPQAPPMMAALPSNTGR..SLFGLKT.GSR..GGRMTMA" |
| 78 |
|
+ "AYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDD" |
| 79 |
|
+ "QSFLDDDQIDEGWVLTCAAYPVSDVTIETHKEEELTA.", 1, 147); |
| 80 |
|
|
| 81 |
|
int u = SiftsClient.UNASSIGNED; |
| 82 |
|
|
| 83 |
|
HashMap<Integer, int[]> expectedMapping = new HashMap<Integer, int[]>(); |
| 84 |
|
|
| |
|
| 100% |
Uncovered Elements: 0 (97) |
Complexity: 1 |
Complexity Density: 0.01 |
|
| 85 |
4 |
@BeforeTest(alwaysRun = true)... |
| 86 |
|
public void populateExpectedMapping() throws SiftsException |
| 87 |
|
{ |
| 88 |
4 |
expectedMapping.put(51, new int[] { 1, 2, 1 }); |
| 89 |
4 |
expectedMapping.put(52, new int[] { 2, 7, 2 }); |
| 90 |
4 |
expectedMapping.put(53, new int[] { 3, 12, 3 }); |
| 91 |
4 |
expectedMapping.put(54, new int[] { 4, 24, 4 }); |
| 92 |
4 |
expectedMapping.put(55, new int[] { 5, 33, 5 }); |
| 93 |
4 |
expectedMapping.put(56, new int[] { 6, 40, 6 }); |
| 94 |
4 |
expectedMapping.put(57, new int[] { 7, 47, 7 }); |
| 95 |
4 |
expectedMapping.put(58, new int[] { 8, 55, 8 }); |
| 96 |
4 |
expectedMapping.put(59, new int[] { 9, 62, 9 }); |
| 97 |
4 |
expectedMapping.put(60, new int[] { 10, 69, 10 }); |
| 98 |
4 |
expectedMapping.put(61, new int[] { 11, 76, 11 }); |
| 99 |
4 |
expectedMapping.put(62, new int[] { 12, 83, 12 }); |
| 100 |
4 |
expectedMapping.put(63, new int[] { 13, 87, 13 }); |
| 101 |
4 |
expectedMapping.put(64, new int[] { 14, 95, 14 }); |
| 102 |
4 |
expectedMapping.put(65, new int[] { 15, 102, 15 }); |
| 103 |
4 |
expectedMapping.put(66, new int[] { 16, 111, 16 }); |
| 104 |
4 |
expectedMapping.put(67, new int[] { 17, 122, 17 }); |
| 105 |
4 |
expectedMapping.put(68, new int[] { 18, 131, 18 }); |
| 106 |
4 |
expectedMapping.put(69, new int[] { 19, 137, 19 }); |
| 107 |
4 |
expectedMapping.put(70, new int[] { 20, 144, 20 }); |
| 108 |
4 |
expectedMapping.put(71, new int[] { 21, 152, 21 }); |
| 109 |
4 |
expectedMapping.put(72, new int[] { 22, 160, 22 }); |
| 110 |
4 |
expectedMapping.put(73, new int[] { 23, 167, 23 }); |
| 111 |
4 |
expectedMapping.put(74, new int[] { 24, 179, 24 }); |
| 112 |
4 |
expectedMapping.put(75, new int[] { 25, 187, 25 }); |
| 113 |
4 |
expectedMapping.put(76, new int[] { 26, 195, 26 }); |
| 114 |
4 |
expectedMapping.put(77, new int[] { 27, 203, 27 }); |
| 115 |
4 |
expectedMapping.put(78, new int[] { 28, 208, 28 }); |
| 116 |
4 |
expectedMapping.put(79, new int[] { 29, 213, 29 }); |
| 117 |
4 |
expectedMapping.put(80, new int[] { 30, 222, 30 }); |
| 118 |
4 |
expectedMapping.put(81, new int[] { 31, 231, 31 }); |
| 119 |
4 |
expectedMapping.put(82, new int[] { 32, 240, 32 }); |
| 120 |
4 |
expectedMapping.put(83, new int[] { 33, 244, 33 }); |
| 121 |
4 |
expectedMapping.put(84, new int[] { 34, 252, 34 }); |
| 122 |
4 |
expectedMapping.put(85, new int[] { 35, 260, 35 }); |
| 123 |
4 |
expectedMapping.put(86, new int[] { 36, 268, 36 }); |
| 124 |
4 |
expectedMapping.put(87, new int[] { 37, 275, 37 }); |
| 125 |
4 |
expectedMapping.put(88, new int[] { 38, 287, 38 }); |
| 126 |
4 |
expectedMapping.put(89, new int[] { 39, 293, 39 }); |
| 127 |
4 |
expectedMapping.put(90, new int[] { 40, 299, 40 }); |
| 128 |
4 |
expectedMapping.put(91, new int[] { 41, 310, 41 }); |
| 129 |
4 |
expectedMapping.put(92, new int[] { 42, 315, 42 }); |
| 130 |
4 |
expectedMapping.put(93, new int[] { 43, 319, 43 }); |
| 131 |
4 |
expectedMapping.put(94, new int[] { 44, 325, 44 }); |
| 132 |
4 |
expectedMapping.put(95, new int[] { 45, 331, 45 }); |
| 133 |
4 |
expectedMapping.put(96, new int[] { 46, 337, 46 }); |
| 134 |
4 |
expectedMapping.put(97, new int[] { 47, 343, 47 }); |
| 135 |
4 |
expectedMapping.put(98, new int[] { 48, 349, 48 }); |
| 136 |
4 |
expectedMapping.put(99, new int[] { 49, 354, 49 }); |
| 137 |
4 |
expectedMapping.put(100, new int[] { 50, 358, 50 }); |
| 138 |
4 |
expectedMapping.put(101, new int[] { 51, 367, 51 }); |
| 139 |
4 |
expectedMapping.put(102, new int[] { 52, 375, 52 }); |
| 140 |
4 |
expectedMapping.put(103, new int[] { 53, 384, 53 }); |
| 141 |
4 |
expectedMapping.put(104, new int[] { 54, 391, 54 }); |
| 142 |
4 |
expectedMapping.put(105, new int[] { 55, 395, 55 }); |
| 143 |
4 |
expectedMapping.put(106, new int[] { 56, 401, 56 }); |
| 144 |
4 |
expectedMapping.put(107, new int[] { 57, 409, 57 }); |
| 145 |
4 |
expectedMapping.put(108, new int[] { 58, 417, 58 }); |
| 146 |
4 |
expectedMapping.put(109, new int[] { 59, 426, 59 }); |
| 147 |
4 |
expectedMapping.put(110, new int[] { 60, 434, 60 }); |
| 148 |
4 |
expectedMapping.put(111, new int[] { 61, 442, 61 }); |
| 149 |
4 |
expectedMapping.put(112, new int[] { 62, 451, 62 }); |
| 150 |
4 |
expectedMapping.put(113, new int[] { 63, 457, 63 }); |
| 151 |
4 |
expectedMapping.put(114, new int[] { 64, 468, 64 }); |
| 152 |
4 |
expectedMapping.put(115, new int[] { 65, 476, 65 }); |
| 153 |
4 |
expectedMapping.put(116, new int[] { 66, 484, 66 }); |
| 154 |
4 |
expectedMapping.put(117, new int[] { 67, 492, 67 }); |
| 155 |
4 |
expectedMapping.put(118, new int[] { 68, 500, 68 }); |
| 156 |
4 |
expectedMapping.put(119, new int[] { 69, 509, 69 }); |
| 157 |
4 |
expectedMapping.put(120, new int[] { 70, 517, 70 }); |
| 158 |
4 |
expectedMapping.put(121, new int[] { 71, 525, 71 }); |
| 159 |
4 |
expectedMapping.put(122, new int[] { 72, 534, 72 }); |
| 160 |
4 |
expectedMapping.put(123, new int[] { 73, 538, 73 }); |
| 161 |
4 |
expectedMapping.put(124, new int[] { 74, 552, 74 }); |
| 162 |
4 |
expectedMapping.put(125, new int[] { 75, 559, 75 }); |
| 163 |
4 |
expectedMapping.put(126, new int[] { 76, 567, 76 }); |
| 164 |
4 |
expectedMapping.put(127, new int[] { 77, 574, 77 }); |
| 165 |
4 |
expectedMapping.put(128, new int[] { 78, 580, 78 }); |
| 166 |
4 |
expectedMapping.put(129, new int[] { 79, 585, 79 }); |
| 167 |
4 |
expectedMapping.put(130, new int[] { 80, 590, 80 }); |
| 168 |
4 |
expectedMapping.put(131, new int[] { 81, 602, 81 }); |
| 169 |
4 |
expectedMapping.put(132, new int[] { 82, 609, 82 }); |
| 170 |
4 |
expectedMapping.put(133, new int[] { 83, 616, 83 }); |
| 171 |
4 |
expectedMapping.put(134, new int[] { 84, 622, 84 }); |
| 172 |
4 |
expectedMapping.put(135, new int[] { 85, 630, 85 }); |
| 173 |
4 |
expectedMapping.put(136, new int[] { 86, 637, 86 }); |
| 174 |
4 |
expectedMapping.put(137, new int[] { 87, 644, 87 }); |
| 175 |
4 |
expectedMapping.put(138, new int[] { 88, 652, 88 }); |
| 176 |
4 |
expectedMapping.put(139, new int[] { 89, 661, 89 }); |
| 177 |
4 |
expectedMapping.put(140, new int[] { 90, 668, 90 }); |
| 178 |
4 |
expectedMapping.put(141, new int[] { 91, 678, 91 }); |
| 179 |
4 |
expectedMapping.put(142, new int[] { 92, 687, 92 }); |
| 180 |
4 |
expectedMapping.put(143, new int[] { 93, 696, 93 }); |
| 181 |
4 |
expectedMapping.put(144, new int[] { 94, 705, 94 }); |
| 182 |
4 |
expectedMapping.put(145, new int[] { 95, 714, 95 }); |
| 183 |
4 |
expectedMapping.put(146, new int[] { 96, 722, 96 }); |
| 184 |
4 |
expectedMapping.put(147, new int[] { 97, 729, 97 }); |
| 185 |
|
} |
| 186 |
|
|
| |
|
| 90% |
Uncovered Elements: 1 (10) |
Complexity: 2 |
Complexity Density: 0.2 |
|
| 187 |
4 |
@BeforeTest(alwaysRun = true)... |
| 188 |
|
public void setUpSiftsClient() throws SiftsException, IOException |
| 189 |
|
{ |
| 190 |
|
|
| 191 |
4 |
Cache.loadProperties("test/jalview/io/testProps.jvprops"); |
| 192 |
|
|
| 193 |
|
|
| 194 |
4 |
SiftsSettings.setSiftDownloadDirectory(jalview.bin.Cache.getDefault( |
| 195 |
|
"sifts_download_dir", DEFAULT_SIFTS_DOWNLOAD_DIR)); |
| 196 |
4 |
SiftsSettings.setMapWithSifts(true); |
| 197 |
4 |
SiftsSettings.setCacheThresholdInDays("2"); |
| 198 |
4 |
SiftsSettings.setFailSafePIDThreshold("70"); |
| 199 |
4 |
PDBfile pdbFile; |
| 200 |
|
|
| 201 |
4 |
pdbFile = new PDBfile(false, false, false, "test/jalview/io/" |
| 202 |
|
+ testPDBId + ".pdb", DataSourceType.FILE); |
| 203 |
|
|
| 204 |
|
|
| 205 |
4 |
try { |
| 206 |
4 |
siftsClient = new SiftsClient(pdbFile); |
| 207 |
|
} |
| 208 |
|
catch (Exception x) |
| 209 |
|
{ |
| 210 |
0 |
System.err.println("SiftsClientTest setupSiftsClient failed."); |
| 211 |
|
} |
| 212 |
|
} |
| 213 |
|
|
| |
|
| 100% |
Uncovered Elements: 0 (1) |
Complexity: 1 |
Complexity Density: 1 |
|
| 214 |
3 |
@AfterTest(alwaysRun = true)... |
| 215 |
|
public void cleanUpSiftsClient() |
| 216 |
|
{ |
| 217 |
3 |
siftsClient = null; |
| 218 |
|
} |
| 219 |
|
|
| |
|
| 100% |
Uncovered Elements: 0 (2) |
Complexity: 1 |
Complexity Density: 0.5 |
1PASS
|
|
| 220 |
1 |
@Test(groups = { "Functional" })... |
| 221 |
|
public void testSIFTsDownloadURL() |
| 222 |
|
{ |
| 223 |
1 |
String expectedUrl = "https://ftp.ebi.ac.uk/pub/databases/msd/sifts/split_xml/xy/1xyz.sifts.xml.gz"; |
| 224 |
1 |
Assert.assertEquals(SiftsClient.getDownloadUrlFor("1xyz.sifts.xml.gz"), |
| 225 |
|
expectedUrl); |
| 226 |
|
} |
| 227 |
|
|
| |
|
| 0% |
Uncovered Elements: 17 (17) |
Complexity: 2 |
Complexity Density: 0.12 |
1PASS
|
|
| 228 |
0 |
@Test(groups = { "Network" })... |
| 229 |
|
public void getSIFTsFileTest() throws SiftsException, IOException |
| 230 |
|
{ |
| 231 |
0 |
File siftsFile; |
| 232 |
0 |
siftsFile = SiftsClient.downloadSiftsFile(testPDBId); |
| 233 |
0 |
FileAssert.assertFile(siftsFile); |
| 234 |
0 |
long t1 = siftsFile.lastModified(); |
| 235 |
|
|
| 236 |
|
|
| 237 |
0 |
siftsFile = SiftsClient.getSiftsFile(testPDBId); |
| 238 |
0 |
FileAssert.assertFile(siftsFile); |
| 239 |
0 |
long t2 = siftsFile.lastModified(); |
| 240 |
0 |
assertEquals(t1, t2); |
| 241 |
|
|
| 242 |
|
|
| 243 |
|
|
| 244 |
|
|
| 245 |
|
|
| 246 |
|
|
| 247 |
0 |
synchronized (this) |
| 248 |
|
{ |
| 249 |
0 |
try |
| 250 |
|
{ |
| 251 |
0 |
wait(1000); |
| 252 |
|
} catch (InterruptedException e) |
| 253 |
|
{ |
| 254 |
|
} |
| 255 |
|
} |
| 256 |
0 |
SiftsSettings.setCacheThresholdInDays("0"); |
| 257 |
0 |
siftsFile = SiftsClient.getSiftsFile(testPDBId); |
| 258 |
0 |
FileAssert.assertFile(siftsFile); |
| 259 |
0 |
long t3 = siftsFile.lastModified(); |
| 260 |
0 |
assertTrue(t3 > t2, "file timestamp unchanged at " + t3); |
| 261 |
|
|
| 262 |
0 |
SiftsSettings.setCacheThresholdInDays("2"); |
| 263 |
|
} |
| 264 |
|
|
| |
|
| 0% |
Uncovered Elements: 5 (5) |
Complexity: 1 |
Complexity Density: 0.2 |
1PASS
|
|
| 265 |
0 |
@Test(groups = { "Network" })... |
| 266 |
|
public void downloadSiftsFileTest() throws SiftsException, IOException |
| 267 |
|
{ |
| 268 |
|
|
| 269 |
|
|
| 270 |
0 |
Assert.assertTrue(SiftsClient.deleteSiftsFileByPDBId(testPDBId)); |
| 271 |
0 |
File siftsFile; |
| 272 |
0 |
siftsFile = SiftsClient.downloadSiftsFile(testPDBId); |
| 273 |
0 |
FileAssert.assertFile(siftsFile); |
| 274 |
0 |
SiftsClient.downloadSiftsFile(testPDBId); |
| 275 |
|
} |
| 276 |
|
|
| |
|
| 0% |
Uncovered Elements: 3 (3) |
Complexity: 1 |
Complexity Density: 0.33 |
1PASS
|
|
| 277 |
0 |
@Test(groups = { "Network" })... |
| 278 |
|
public void getAllMappingAccessionTest() |
| 279 |
|
{ |
| 280 |
0 |
Assert.assertNotNull(siftsClient); |
| 281 |
0 |
Assert.assertNotNull(siftsClient.getAllMappingAccession()); |
| 282 |
0 |
Assert.assertTrue(siftsClient.getAllMappingAccession().size() > 1); |
| 283 |
|
} |
| 284 |
|
|
| |
|
| 0% |
Uncovered Elements: 19 (19) |
Complexity: 3 |
Complexity Density: 0.18 |
1PASS
|
|
| 285 |
0 |
@Test(groups = { "Network" })... |
| 286 |
|
public void getGreedyMappingTest() |
| 287 |
|
{ |
| 288 |
0 |
Assert.assertNotNull(siftsClient); |
| 289 |
0 |
Assert.assertNotNull(testSeq); |
| 290 |
0 |
Assert.assertNotNull(expectedMapping); |
| 291 |
|
|
| 292 |
|
|
| 293 |
0 |
DBRefEntry dbRef = new DBRefEntry("uniprot", "", "P00221"); |
| 294 |
0 |
testSeq.addDBRef(dbRef); |
| 295 |
|
|
| 296 |
|
|
| 297 |
0 |
try |
| 298 |
|
{ |
| 299 |
0 |
HashMap<Integer, int[]> actualMapping = siftsClient.getGreedyMapping( |
| 300 |
|
"A", testSeq, null); |
| 301 |
0 |
Assert.assertEquals(testSeq.getStart(), 1); |
| 302 |
0 |
Assert.assertEquals(testSeq.getEnd(), 147); |
| 303 |
|
|
| 304 |
|
|
| 305 |
0 |
Assert.assertEquals(actualMapping.size(), expectedMapping.size()); |
| 306 |
0 |
Iterator<Map.Entry<Integer, int[]>> it = expectedMapping.entrySet() |
| 307 |
|
.iterator(); |
| 308 |
0 |
while (it.hasNext()) |
| 309 |
|
{ |
| 310 |
0 |
Map.Entry<Integer, int[]> pair = it.next(); |
| 311 |
0 |
Assert.assertTrue(actualMapping.containsKey(pair.getKey())); |
| 312 |
0 |
Assert.assertEquals(actualMapping.get(pair.getKey()), |
| 313 |
|
pair.getValue()); |
| 314 |
|
} |
| 315 |
|
|
| 316 |
|
} catch (Exception e) |
| 317 |
|
{ |
| 318 |
0 |
e.printStackTrace(); |
| 319 |
0 |
Assert.fail("Exception thrown while generating mapping..."); |
| 320 |
|
} |
| 321 |
|
} |
| 322 |
|
|
| |
|
| 0% |
Uncovered Elements: 9 (9) |
Complexity: 1 |
Complexity Density: 0.11 |
|
| 323 |
0 |
@Test(groups = { "Network" })... |
| 324 |
|
private void getAtomIndexTest() |
| 325 |
|
{ |
| 326 |
0 |
ArrayList<Atom> atoms = new ArrayList<Atom>(); |
| 327 |
0 |
Atom atom = new Atom(u, u, u); |
| 328 |
0 |
atom.resNumber = 43; |
| 329 |
0 |
atom.atomIndex = 7; |
| 330 |
0 |
atoms.add(atom); |
| 331 |
0 |
int actualAtomIndex = siftsClient.getAtomIndex(1, atoms); |
| 332 |
0 |
Assert.assertEquals(actualAtomIndex, SiftsClient.UNASSIGNED); |
| 333 |
0 |
actualAtomIndex = siftsClient.getAtomIndex(43, atoms); |
| 334 |
0 |
Assert.assertEquals(actualAtomIndex, 7); |
| 335 |
|
} |
| 336 |
|
|
| |
|
| 0% |
Uncovered Elements: 1 (1) |
Complexity: 1 |
Complexity Density: 1 |
|
| 337 |
0 |
@Test(... |
| 338 |
|
groups = { "Network" }, |
| 339 |
|
expectedExceptions = IllegalArgumentException.class) |
| 340 |
|
private void getAtomIndexNullTest() |
| 341 |
|
{ |
| 342 |
0 |
siftsClient.getAtomIndex(1, null); |
| 343 |
|
} |
| 344 |
|
|
| |
|
| - |
Uncovered Elements: 0 (0) |
Complexity: 1 |
Complexity Density: - |
|
| 345 |
0 |
@Test(groups = { "Network" })... |
| 346 |
|
private void padWithGapsTest() |
| 347 |
|
{ |
| 348 |
|
|
| 349 |
|
} |
| 350 |
|
|
| |
|
| 0% |
Uncovered Elements: 1 (1) |
Complexity: 1 |
Complexity Density: 1 |
|
| 351 |
0 |
@Test(... |
| 352 |
|
groups = { "Network" }, |
| 353 |
|
expectedExceptions = SiftsException.class) |
| 354 |
|
private void populateAtomPositionsNullTest1() |
| 355 |
|
throws IllegalArgumentException, SiftsException |
| 356 |
|
{ |
| 357 |
0 |
siftsClient.populateAtomPositions(null, null); |
| 358 |
|
} |
| 359 |
|
|
| |
|
| 0% |
Uncovered Elements: 1 (1) |
Complexity: 1 |
Complexity Density: 1 |
|
| 360 |
0 |
@Test(... |
| 361 |
|
groups = { "Network" }, |
| 362 |
|
expectedExceptions = SiftsException.class) |
| 363 |
|
private void populateAtomPositionsNullTest2() |
| 364 |
|
throws IllegalArgumentException, SiftsException |
| 365 |
|
{ |
| 366 |
0 |
siftsClient.populateAtomPositions("A", null); |
| 367 |
|
} |
| 368 |
|
|
| |
|
| 0% |
Uncovered Elements: 6 (6) |
Complexity: 1 |
Complexity Density: 0.17 |
1PASS
|
|
| 369 |
0 |
@Test(groups = { "Network" })... |
| 370 |
|
public void getValidSourceDBRefTest() throws SiftsException |
| 371 |
|
{ |
| 372 |
0 |
DBRefEntryI actualValidSrcDBRef = siftsClient |
| 373 |
|
.getValidSourceDBRef(testSeq); |
| 374 |
0 |
DBRefEntryI expectedDBRef = new DBRefEntry(); |
| 375 |
0 |
expectedDBRef.setSource(DBRefSource.UNIPROT); |
| 376 |
0 |
expectedDBRef.setAccessionId("P00221"); |
| 377 |
0 |
expectedDBRef.setVersion(""); |
| 378 |
0 |
Assert.assertEquals(actualValidSrcDBRef, expectedDBRef); |
| 379 |
|
} |
| 380 |
|
|
| |
|
| 0% |
Uncovered Elements: 2 (2) |
Complexity: 1 |
Complexity Density: 0.5 |
1PASS
|
|
| 381 |
0 |
@Test(... |
| 382 |
|
groups = { "Network" }, |
| 383 |
|
expectedExceptions = SiftsException.class) |
| 384 |
|
public void getValidSourceDBRefExceptionTest() throws SiftsException |
| 385 |
|
{ |
| 386 |
0 |
SequenceI invalidTestSeq = new Sequence("testSeq", "ABCDEFGH"); |
| 387 |
0 |
siftsClient.getValidSourceDBRef(invalidTestSeq); |
| 388 |
|
} |
| 389 |
|
|
| |
|
| 0% |
Uncovered Elements: 5 (5) |
Complexity: 1 |
Complexity Density: 0.2 |
1PASS
|
|
| 390 |
0 |
@Test(... |
| 391 |
|
groups = { "Network" }, |
| 392 |
|
expectedExceptions = SiftsException.class) |
| 393 |
|
public void getValidSourceDBRefExceptionXTest() throws SiftsException |
| 394 |
|
{ |
| 395 |
0 |
SequenceI invalidTestSeq = new Sequence("testSeq", "ABCDEFGH"); |
| 396 |
0 |
DBRefEntry invalidDBRef = new DBRefEntry(); |
| 397 |
0 |
invalidDBRef.setAccessionId("BLAR"); |
| 398 |
|
|
| 399 |
0 |
invalidTestSeq.addDBRef(invalidDBRef); |
| 400 |
0 |
siftsClient.getValidSourceDBRef(invalidTestSeq); |
| 401 |
|
} |
| 402 |
|
|
| |
|
| 0% |
Uncovered Elements: 5 (5) |
Complexity: 1 |
Complexity Density: 0.2 |
1PASS
|
|
| 403 |
0 |
@Test(groups = { "Network" })... |
| 404 |
|
public void isValidDBRefEntryTest() |
| 405 |
|
{ |
| 406 |
0 |
DBRefEntryI validDBRef = new DBRefEntry(); |
| 407 |
0 |
validDBRef.setSource(DBRefSource.UNIPROT); |
| 408 |
0 |
validDBRef.setAccessionId("P00221"); |
| 409 |
0 |
validDBRef.setVersion(""); |
| 410 |
0 |
Assert.assertTrue(siftsClient.isValidDBRefEntry(validDBRef)); |
| 411 |
|
} |
| 412 |
|
|
| |
|
| 0% |
Uncovered Elements: 12 (12) |
Complexity: 2 |
Complexity Density: 0.2 |
1PASS
|
|
| 413 |
0 |
@Test(groups = { "Network" })... |
| 414 |
|
public void getSiftsStructureMappingTest() throws SiftsException |
| 415 |
|
{ |
| 416 |
0 |
Assert.assertTrue(SiftsSettings.isMapWithSifts()); |
| 417 |
0 |
StructureMapping strucMapping = siftsClient.getSiftsStructureMapping( |
| 418 |
|
testSeq, testPDBId, "A"); |
| 419 |
0 |
String expectedMappingOutput = "\nSequence ⟷ Structure mapping details\n" |
| 420 |
|
+ "Method: SIFTS\n\n" |
| 421 |
|
+ "P00221 : 51 - 147 Maps to \n" |
| 422 |
|
+ "1A70|A : 1 - 97\n\n" |
| 423 |
|
+ "P00221 AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLD\n" |
| 424 |
|
+ " |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||\n" |
| 425 |
|
+ "1A70|A AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLD\n\n" |
| 426 |
|
|
| 427 |
|
+ "P00221 DDQIDEGWVLTCAAYPVSDVTIETHKEEELTA\n" |
| 428 |
|
+ " |||||||||||||||||||||||||| |||||\n" |
| 429 |
|
+ "1A70|A DDQIDEGWVLTCAAYPVSDVTIETHKKEELTA\n\n" + |
| 430 |
|
|
| 431 |
|
"Length of alignment = 97\n" + "Percentage ID = 98.97\n"; |
| 432 |
|
|
| 433 |
0 |
Assert.assertEquals(strucMapping.getMappingDetailsOutput(), |
| 434 |
|
expectedMappingOutput); |
| 435 |
|
|
| 436 |
|
|
| 437 |
|
|
| 438 |
0 |
Assert.assertEquals(strucMapping.getMapping().size(), |
| 439 |
|
expectedMapping.size()); |
| 440 |
0 |
Iterator<Map.Entry<Integer, int[]>> it = expectedMapping.entrySet() |
| 441 |
|
.iterator(); |
| 442 |
0 |
while (it.hasNext()) |
| 443 |
|
{ |
| 444 |
0 |
Map.Entry<Integer, int[]> pair = it.next(); |
| 445 |
0 |
Assert.assertTrue(strucMapping.getMapping() |
| 446 |
|
.containsKey(pair.getKey())); |
| 447 |
0 |
Assert.assertEquals(strucMapping.getMapping().get(pair.getKey()), |
| 448 |
|
pair.getValue()); |
| 449 |
|
} |
| 450 |
|
} |
| 451 |
|
|
| |
|
| 0% |
Uncovered Elements: 3 (3) |
Complexity: 1 |
Complexity Density: 0.33 |
1PASS
|
|
| 452 |
0 |
@Test(groups = { "Network" })... |
| 453 |
|
public void getEntityCountTest() |
| 454 |
|
{ |
| 455 |
0 |
int actualEntityCount = siftsClient.getEntityCount(); |
| 456 |
0 |
System.out.println("actual entity count : " + actualEntityCount); |
| 457 |
0 |
Assert.assertEquals(actualEntityCount, 1); |
| 458 |
|
} |
| 459 |
|
|
| |
|
| 0% |
Uncovered Elements: 3 (3) |
Complexity: 1 |
Complexity Density: 0.33 |
1PASS
|
|
| 460 |
0 |
@Test(groups = { "Network" })... |
| 461 |
|
public void getDbAccessionIdTest() |
| 462 |
|
{ |
| 463 |
0 |
String actualDbAccId = siftsClient.getDbAccessionId(); |
| 464 |
0 |
System.out.println("Actual Db Accession Id: " + actualDbAccId); |
| 465 |
0 |
Assert.assertEquals(actualDbAccId, "1a70"); |
| 466 |
|
} |
| 467 |
|
|
| |
|
| 0% |
Uncovered Elements: 3 (3) |
Complexity: 1 |
Complexity Density: 0.33 |
1PASS
|
|
| 468 |
0 |
@Test(groups = { "Network" })... |
| 469 |
|
public void getDbCoordSysTest() |
| 470 |
|
{ |
| 471 |
0 |
String actualDbCoordSys = siftsClient.getDbCoordSys(); |
| 472 |
0 |
System.out.println("Actual DbCoordSys: " + actualDbCoordSys); |
| 473 |
0 |
Assert.assertEquals(actualDbCoordSys, "PDBe"); |
| 474 |
|
} |
| 475 |
|
|
| |
|
| 0% |
Uncovered Elements: 3 (3) |
Complexity: 1 |
Complexity Density: 0.33 |
1PASS
|
|
| 476 |
0 |
@Test(groups = { "Network" })... |
| 477 |
|
public void getDbSourceTest() |
| 478 |
|
{ |
| 479 |
0 |
String actualDbSource = siftsClient.getDbSource(); |
| 480 |
0 |
System.out.println("Actual DbSource: " + actualDbSource); |
| 481 |
0 |
Assert.assertEquals(actualDbSource, "PDBe"); |
| 482 |
|
} |
| 483 |
|
|
| |
|
| 0% |
Uncovered Elements: 3 (3) |
Complexity: 1 |
Complexity Density: 0.33 |
1PASS
|
|
| 484 |
0 |
@Test(groups = { "Network" })... |
| 485 |
|
public void getDbVersionTest() |
| 486 |
|
{ |
| 487 |
0 |
String actualDbVersion = siftsClient.getDbVersion(); |
| 488 |
0 |
System.out.println("Actual DbVersion: " + actualDbVersion); |
| 489 |
0 |
Assert.assertEquals(actualDbVersion, "2.0"); |
| 490 |
|
} |
| 491 |
|
|
| |
|
| 0% |
Uncovered Elements: 12 (12) |
Complexity: 1 |
Complexity Density: 0.08 |
1PASS
|
|
| 492 |
0 |
@Test(groups = { "Network" })... |
| 493 |
|
public void getEntityByMostOptimalMatchedIdTest1() throws IOException, |
| 494 |
|
SiftsException |
| 495 |
|
{ |
| 496 |
0 |
SiftsClient siftsClientX = null; |
| 497 |
0 |
PDBfile pdbFile; |
| 498 |
0 |
pdbFile = new PDBfile(false, false, false, "test/jalview/io/2nq2" |
| 499 |
|
+ ".pdb", DataSourceType.FILE); |
| 500 |
0 |
siftsClientX = new SiftsClient(pdbFile); |
| 501 |
0 |
Entity entityA = siftsClientX.getEntityByMostOptimalMatchedId("A"); |
| 502 |
0 |
Assert.assertEquals(entityA.getEntityId(), "A"); |
| 503 |
0 |
Entity entityB = siftsClientX.getEntityByMostOptimalMatchedId("B"); |
| 504 |
0 |
Assert.assertEquals(entityB.getEntityId(), "C"); |
| 505 |
0 |
Entity entityC = siftsClientX.getEntityByMostOptimalMatchedId("C"); |
| 506 |
0 |
Assert.assertEquals(entityC.getEntityId(), "B"); |
| 507 |
0 |
Entity entityD = siftsClientX.getEntityByMostOptimalMatchedId("D"); |
| 508 |
0 |
Assert.assertEquals(entityD.getEntityId(), "D"); |
| 509 |
|
|
| 510 |
|
} |
| 511 |
|
|
| |
|
| 0% |
Uncovered Elements: 14 (14) |
Complexity: 1 |
Complexity Density: 0.07 |
1PASS
|
|
| 512 |
0 |
@Test(groups = { "Network" })... |
| 513 |
|
public void getEntityByMostOptimalMatchedIdTest2() throws IOException, |
| 514 |
|
SiftsException |
| 515 |
|
{ |
| 516 |
|
|
| 517 |
|
|
| 518 |
|
|
| 519 |
0 |
SiftsClient siftsClientX = null; |
| 520 |
0 |
PDBfile pdbFile; |
| 521 |
0 |
pdbFile = new PDBfile(false, false, false, "test/jalview/io/3ucu.cif", |
| 522 |
|
DataSourceType.FILE); |
| 523 |
0 |
siftsClientX = new SiftsClient(pdbFile); |
| 524 |
0 |
Entity entityA = siftsClientX.getEntityByMostOptimalMatchedId("P"); |
| 525 |
0 |
Entity entityP = siftsClientX.getEntityByMostOptimalMatchedId("A"); |
| 526 |
0 |
Entity entityR = siftsClientX.getEntityByMostOptimalMatchedId("R"); |
| 527 |
0 |
Assert.assertEquals(entityA.getEntityId(), "A"); |
| 528 |
0 |
Assert.assertNotEquals(entityR, "A"); |
| 529 |
0 |
Assert.assertNotEquals(entityP, "A"); |
| 530 |
0 |
Assert.assertNotEquals(entityR, "R"); |
| 531 |
0 |
Assert.assertNotEquals(entityP, "P"); |
| 532 |
0 |
Assert.assertNull(entityR); |
| 533 |
0 |
Assert.assertNull(entityP); |
| 534 |
|
|
| 535 |
|
} |
| 536 |
|
} |