Clover icon

Coverage Report

  1. Project Clover database Tue Jun 16 2026 16:23:44 BST
  2. Package jalview.structure

File Mapping.java

 

Coverage histogram

../../img/srcFileCovDistChart3.png
52% of files have more coverage

Code metrics

24
109
5
1
314
242
18
0.17
21.8
5
3.6

Classes

Class Line # Actions
Mapping 42 109 18
0.275362327.5%
 

Contributing tests

No tests hitting this source file were found.

Source view

1    /*
2    * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
3    * Copyright (C) $$Year-Rel$$ The Jalview Authors
4    *
5    * This file is part of Jalview.
6    *
7    * Jalview is free software: you can redistribute it and/or
8    * modify it under the terms of the GNU General Public License
9    * as published by the Free Software Foundation, either version 3
10    * of the License, or (at your option) any later version.
11    *
12    * Jalview is distributed in the hope that it will be useful, but
13    * WITHOUT ANY WARRANTY; without even the implied warranty
14    * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
15    * PURPOSE. See the GNU General Public License for more details.
16    *
17    * You should have received a copy of the GNU General Public License
18    * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
19    * The Jalview Authors are detailed in the 'AUTHORS' file.
20    */
21    package jalview.structure;
22   
23    import static org.testng.AssertJUnit.assertEquals;
24    import static org.testng.AssertJUnit.assertTrue;
25   
26    import org.testng.Assert;
27    import org.testng.AssertJUnit;
28    import org.testng.annotations.BeforeClass;
29    import org.testng.annotations.Test;
30   
31    import jalview.datamodel.AlignmentAnnotation;
32    import jalview.datamodel.Annotation;
33    import jalview.datamodel.Sequence;
34    import jalview.datamodel.SequenceI;
35    import jalview.gui.AlignFrame;
36    import jalview.gui.JvOptionPane;
37    import jalview.io.DataSourceType;
38    import jalview.io.FileFormat;
39    import jalview.io.FileLoader;
40    import jalview.io.StructureFile;
41   
 
42    public class Mapping
43    {
44   
 
45  1 toggle @BeforeClass(alwaysRun = true)
46    public void setUpJvOptionPane()
47    {
48  1 JvOptionPane.setInteractiveMode(false);
49  1 JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION);
50    }
51   
52    /*
53    * more test data
54    *
55    * 1QCF|A/101-121 SFQKGDQMVVLEESGEWWKAR Ser 114 jumps to Gly 116 at position
56    * 115 in PDB Res Numbering secondary structure numbers in jmol seem to be in
57    * msd numbering, not pdb res numbering.
58    */
 
59  0 toggle @Test(groups = { "Functional" }, enabled = false)
60    public void pdbEntryPositionMap() throws Exception
61    {
62  0 Assert.fail("This test intentionally left to fail");
63  0 for (int offset = 0; offset < 20; offset += 6)
64    {
65    // check we put the secondary structure in the right position
66  0 Sequence uprot = new Sequence("TheProtSeq",
67    "DAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTL");
68  0 uprot.setStart(offset + 258); // make it harder - create a fake
69    // relocation problem for jalview to
70    // deal with
71  0 uprot.setEnd(uprot.getStart() + uprot.getLength() - 1);
72    // original numbers taken from
73    // http://www.ebi.ac.uk/pdbe-srv/view/entry/1qcf/secondary.html
74    // these are in numbering relative to the subsequence above
75  0 int coils[] = { 266, 275, 278, 287, 289, 298, 302, 316 },
76    helices[] = new int[]
77    { 303, 315 }, sheets[] = new int[] { 267, 268, 269, 270 };
78   
79  0 StructureSelectionManager ssm = StructureSelectionManager
80    .getStructureSelectionManager(null);
81  0 StructureFile pmap = ssm.setMapping(true, new SequenceI[] { uprot },
82    new String[]
83    { "A" }, "test/jalview/ext/jmol/1QCF.pdb",
84    DataSourceType.FILE, null, null);
85  0 assertTrue(pmap != null);
86  0 SequenceI protseq = pmap.getSeqsAsArray()[0];
87  0 AlignmentAnnotation pstra = protseq
88    .getAnnotation("Secondary Structure")[0];
89  0 int pinds, pinde;
90  0 pstra.restrict((pinds = protseq.findIndex(258) - 1),
91    pinde = (protseq.findIndex(317) - 1));
92  0 int op;
93  0 System.out.println("PDB Annot");
94  0 for (char c : protseq.getSubSequence(pinds, pinde).getSequence())
95    {
96  0 System.out.print(c + ", ");
97    }
98  0 System.out.println("\n" + pstra + "\n\nsubsequence\n");
99  0 for (char c : uprot.getSequence())
100    {
101  0 System.out.print(c + ", ");
102    }
103  0 System.out.println("");
104  0 for (AlignmentAnnotation ss : uprot
105    .getAnnotation("Secondary Structure"))
106    {
107  0 ss.adjustForAlignment();
108  0 System.out.println("Uniprot Annot\n" + ss);
109  0 assertTrue(ss.hasIcons);
110  0 char expected = 'H';
111  0 for (int p : helices)
112    {
113  0 Annotation a = ss.annotations[op = (uprot.findIndex(offset + p)
114    - 1)];
115  0 assertTrue("Expected a helix at position " + p
116    + uprot.getCharAt(op) + " but got coil", a != null);
117  0 assertEquals("Expected a helix at position " + p,
118    a.secondaryStructure, expected);
119    }
120  0 expected = 'E';
121  0 for (int p : sheets)
122    {
123  0 Annotation a = ss.annotations[uprot.findIndex(offset + p) - 1];
124  0 assertTrue("Expected a strand at position " + p + " but got coil",
125    a != null);
126  0 assertEquals("Expected a strand at position " + p,
127    a.secondaryStructure, expected);
128    }
129  0 expected = ' ';
130  0 for (int p : coils)
131    {
132  0 Annotation a = ss.annotations[uprot.findIndex(offset + p) - 1];
133  0 assertTrue("Expected coil at position " + p + " but got "
134    + a.secondaryStructure, a == null);
135    }
136    }
137    }
138    }
139   
 
140  0 toggle @Test(groups = { "Functional" }, enabled = false)
141    public void testPDBentryMapping() throws Exception
142    {
143  0 Assert.fail("This test intentionally left to fail");
144  0 Sequence sq = new Sequence("1GAQ A subseq 126 to 219",
145    "EIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKM");
146  0 Sequence sq1 = new Sequence(sq);
147  0 String inFile;
148  0 StructureSelectionManager ssm = StructureSelectionManager
149    .getStructureSelectionManager(null);
150    // Associate the 1GAQ pdb file with the subsequence 'imported' from another
151    // source
152  0 StructureFile pde = ssm.setMapping(true, new SequenceI[] { sq },
153    new String[]
154    { "A" }, inFile = "examples/1gaq.txt", DataSourceType.FILE,
155    null, null);
156  0 assertTrue("PDB File couldn't be found", pde != null);
157  0 StructureMapping[] mp = ssm.getMapping(inFile);
158  0 assertTrue("No mappings made.", mp != null && mp.length > 0);
159  0 int nsecStr = 0, nsTemp = 0;
160    // test for presence of transferred annotation on sequence
161  0 for (AlignmentAnnotation alan : sq.getAnnotation())
162    {
163  0 if (alan.hasIcons)
164    {
165  0 nsecStr++;
166    }
167  0 if (alan.graph == alan.LINE_GRAPH)
168    {
169  0 nsTemp++;
170    }
171    }
172  0 assertEquals(
173    "Only one secondary structure should be transferred to associated sequence.",
174    1, nsecStr);
175  0 assertEquals(
176    "Only two line graphs should be transferred to associated sequence.",
177    2, nsTemp);
178    // Now test the transfer function and compare annotated positions
179  0 for (StructureMapping origMap : mp)
180    {
181  0 if (origMap.getSequence() == sq)
182    {
183  0 assertEquals("Mapping was incomplete.", sq.getLength() - 1,
184    (origMap.getPDBResNum(sq.getEnd())
185    - origMap.getPDBResNum(sq.getStart())));
186    // sanity check - if this fails, mapping from first position in sequence
187    // we want to transfer to is not where we expect
188  0 assertEquals(1, origMap.getSeqPos(126));
189  0 SequenceI firstChain = pde.getSeqs().get(0);
190    // Compare the annotated positions on the PDB chain sequence with the
191    // annotation on the associated sequence
192  0 for (AlignmentAnnotation alan : firstChain.getAnnotation())
193    {
194  0 AlignmentAnnotation transfer = origMap.transfer(alan);
195  0 System.out.println("pdb:" + firstChain.getSequenceAsString());
196  0 System.out.println("ann:" + alan.toString());
197  0 System.out.println("pdb:" + sq.getSequenceAsString());
198  0 System.out.println("ann:" + transfer.toString());
199   
200  0 for (int p = 0, pSize = firstChain.getLength(); p < pSize; p++)
201    {
202    // walk along the pdb chain's jalview sequence
203  0 int rseqpos;
204  0 int fpos = origMap
205    .getSeqPos(rseqpos = firstChain.findPosition(p));
206    // only look at positions where there is a corresponding position in
207    // mapping
208  0 if (fpos < 1)
209    {
210  0 continue;
211    }
212    // p is index into PDB residue entries
213    // rseqpos is pdb sequence position for position p
214    // fpos is sequence position for associated position for rseqpos
215    // tanpos is the column for the mapped sequence position
216  0 int tanpos = sq.findIndex(fpos) - 1;
217  0 if (tanpos < 0 || transfer.annotations.length <= tanpos)
218    {
219    // gone beyond mapping to the sequence
220  0 break;
221    }
222   
223  0 Annotation a = transfer.annotations[tanpos],
224    b = alan.annotations[p];
225  0 assertEquals(
226    "Non-equivalent annotation element at " + p + "("
227    + rseqpos + ")" + " expected at " + fpos
228    + " (alIndex " + tanpos + ")",
229  0 a == null ? a : a.toString(),
230  0 b == null ? b : b.toString());
231  0 System.out.print("(" + a + "|" + b + ")");
232    }
233   
234    }
235    }
236    }
237    }
238   
239    /**
240    * corner case for pdb mapping - revealed a problem with the AlignSeq->Mapping
241    * transform
242    *
243    */
 
244  1 toggle @Test(groups = { "Functional" })
245    public void mapFer1From3W5V() throws Exception
246    {
247  1 AlignFrame seqf = new FileLoader(false).LoadFileWaitTillLoaded(
248    ">FER1_MAIZE/1-150 Ferredoxin-1, chloroplast precursor\nMATVLGSPRAPAFFFSSSSLRAAPAPTAVALPAAKVGIMGRSASSRRRLRAQATYNVKLITPEGEVELQVPD\nDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKE\nEELTGA",
249    DataSourceType.PASTE, FileFormat.Fasta);
250  1 SequenceI newseq = seqf.getViewport().getAlignment().getSequenceAt(0);
251  1 StructureSelectionManager ssm = StructureSelectionManager
252    .getStructureSelectionManager(null);
253  1 StructureFile pmap = ssm.setMapping(true, new SequenceI[] { newseq },
254    new String[]
255    { null }, "examples/3W5V.pdb", DataSourceType.FILE, null, null);
256  1 if (pmap == null)
257    {
258  0 AssertJUnit.fail("Couldn't make a mapping for 3W5V to FER1_MAIZE");
259    }
260    }
261   
262    /**
263    * compare reference annotation for imported pdb sequence to identical
264    * seuqence with transferred annotation from mapped pdb file
265    */
 
266  1 toggle @Test(groups = { "Functional" })
267    public void compareTransferredToRefPDBAnnot() throws Exception
268    {
269  1 StructureImportSettings.setProcessSecondaryStructure(true);
270  1 StructureImportSettings.setVisibleChainAnnotation(true);
271  1 StructureImportSettings.setShowSeqFeatures(true);
272  1 AlignFrame ref = new FileLoader(false).LoadFileWaitTillLoaded(
273    "test/jalview/ext/jmol/1QCF.pdb", DataSourceType.FILE);
274  1 SequenceI refseq = ref.getViewport().getAlignment().getSequenceAt(0);
275  1 SequenceI newseq = new Sequence(refseq.getName() + "Copy",
276    refseq.getSequenceAsString());
277    // make it harder by shifting the copy vs the reference
278  1 newseq.setStart(refseq.getStart() + 25);
279  1 newseq.setEnd(refseq.getLength() + 25 + refseq.getStart());
280  1 StructureSelectionManager ssm = StructureSelectionManager
281    .getStructureSelectionManager(null);
282  1 ssm.setProcessSecondaryStructure(true);
283  1 ssm.setAddTempFacAnnot(true);
284  1 StructureFile pmap = ssm.setMapping(true, new SequenceI[] { newseq },
285    new String[]
286    { null }, "test/jalview/ext/jmol/1QCF.pdb", DataSourceType.FILE,
287    null, null);
288  1 assertTrue(pmap != null);
289  1 assertEquals("Original and copied sequence of different lengths.",
290    refseq.getLength(), newseq.getLength());
291  1 assertTrue(refseq.getAnnotation() != null
292    && refseq.getAnnotation().length > 0);
293  1 assertTrue(newseq.getAnnotation() != null
294    && newseq.getAnnotation().length > 0);
295  1 for (AlignmentAnnotation oannot : refseq.getAnnotation())
296    {
297  2 for (AlignmentAnnotation tannot : newseq.getAnnotation(oannot.label))
298    {
299  902 for (int p = 0, pSize = refseq.getLength(); p < pSize; p++)
300    {
301  900 Annotation orig = oannot.annotations[p],
302    tran = tannot.annotations[p];
303  900 assertTrue("Mismatch: coil and non coil site " + p,
304    orig == tran || orig != null && tran != null);
305  900 if (tran != null)
306    {
307  678 assertEquals("Mismatch in secondary structure at site " + p,
308    tran.secondaryStructure, orig.secondaryStructure);
309    }
310    }
311    }
312    }
313    }
314    }