| 1 |
|
|
| 2 |
|
|
| 3 |
|
|
| 4 |
|
|
| 5 |
|
|
| 6 |
|
|
| 7 |
|
|
| 8 |
|
|
| 9 |
|
|
| 10 |
|
|
| 11 |
|
|
| 12 |
|
|
| 13 |
|
|
| 14 |
|
|
| 15 |
|
|
| 16 |
|
|
| 17 |
|
|
| 18 |
|
|
| 19 |
|
|
| 20 |
|
|
| 21 |
|
package jalview.io; |
| 22 |
|
|
| 23 |
|
import static org.testng.AssertJUnit.assertNotNull; |
| 24 |
|
|
| 25 |
|
import jalview.api.AlignExportSettingsI; |
| 26 |
|
import jalview.datamodel.AlignExportSettingsAdapter; |
| 27 |
|
import jalview.datamodel.Alignment; |
| 28 |
|
import jalview.datamodel.AlignmentAnnotation; |
| 29 |
|
import jalview.datamodel.AlignmentI; |
| 30 |
|
import jalview.datamodel.Annotation; |
| 31 |
|
import jalview.datamodel.HiddenColumns; |
| 32 |
|
import jalview.datamodel.Sequence; |
| 33 |
|
import jalview.datamodel.SequenceFeature; |
| 34 |
|
import jalview.datamodel.SequenceGroup; |
| 35 |
|
import jalview.datamodel.SequenceI; |
| 36 |
|
import jalview.datamodel.features.SequenceFeatures; |
| 37 |
|
import jalview.gui.AlignFrame; |
| 38 |
|
import jalview.gui.JvOptionPane; |
| 39 |
|
import jalview.json.binding.biojson.v1.ColourSchemeMapper; |
| 40 |
|
import jalview.schemes.ColourSchemeI; |
| 41 |
|
import jalview.schemes.ResidueColourScheme; |
| 42 |
|
|
| 43 |
|
import java.io.IOException; |
| 44 |
|
import java.util.ArrayList; |
| 45 |
|
import java.util.HashMap; |
| 46 |
|
import java.util.Iterator; |
| 47 |
|
import java.util.List; |
| 48 |
|
import java.util.Map; |
| 49 |
|
|
| 50 |
|
import org.testng.Assert; |
| 51 |
|
import org.testng.AssertJUnit; |
| 52 |
|
import org.testng.annotations.AfterTest; |
| 53 |
|
import org.testng.annotations.BeforeClass; |
| 54 |
|
import org.testng.annotations.BeforeMethod; |
| 55 |
|
import org.testng.annotations.BeforeTest; |
| 56 |
|
import org.testng.annotations.Test; |
| 57 |
|
|
| |
|
| 83.3% |
Uncovered Elements: 46 (276) |
Complexity: 57 |
Complexity Density: 0.25 |
|
| 58 |
|
public class JSONFileTest |
| 59 |
|
{ |
| 60 |
|
|
| |
|
| 100% |
Uncovered Elements: 0 (2) |
Complexity: 1 |
Complexity Density: 0.5 |
|
| 61 |
1 |
@BeforeClass(alwaysRun = true)... |
| 62 |
|
public void setUpJvOptionPane() |
| 63 |
|
{ |
| 64 |
1 |
JvOptionPane.setInteractiveMode(false); |
| 65 |
1 |
JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION); |
| 66 |
|
} |
| 67 |
|
|
| 68 |
|
private int TEST_SEQ_HEIGHT = 0; |
| 69 |
|
|
| 70 |
|
private int TEST_GRP_HEIGHT = 0; |
| 71 |
|
|
| 72 |
|
private int TEST_ANOT_HEIGHT = 0; |
| 73 |
|
|
| 74 |
|
private int TEST_CS_HEIGHT = 0; |
| 75 |
|
|
| 76 |
|
private String TEST_JSON_FILE = "examples/example.json"; |
| 77 |
|
|
| 78 |
|
private Alignment alignment; |
| 79 |
|
|
| 80 |
|
private HashMap<String, SequenceI> expectedSeqs = new HashMap<>(); |
| 81 |
|
|
| 82 |
|
private HashMap<String, AlignmentAnnotation> expectedAnnots = new HashMap<>(); |
| 83 |
|
|
| 84 |
|
private HashMap<String, SequenceGroup> expectedGrps = new HashMap<>(); |
| 85 |
|
|
| 86 |
|
private HiddenColumns expectedColSel = new HiddenColumns(); |
| 87 |
|
|
| 88 |
|
private SequenceI[] expectedHiddenSeqs = new SequenceI[1]; |
| 89 |
|
|
| 90 |
|
private AlignmentI testAlignment; |
| 91 |
|
|
| 92 |
|
private int passedCount; |
| 93 |
|
|
| 94 |
|
private JSONFile testJsonFile; |
| 95 |
|
|
| 96 |
|
private JSONFile jf; |
| 97 |
|
|
| 98 |
|
private AlignExportSettingsI exportSettings; |
| 99 |
|
|
| |
|
| 98.9% |
Uncovered Elements: 1 (92) |
Complexity: 2 |
Complexity Density: 0.02 |
|
| 100 |
5 |
@BeforeTest(alwaysRun = true)... |
| 101 |
|
public void setup() throws Exception |
| 102 |
|
{ |
| 103 |
|
|
| 104 |
|
|
| 105 |
|
|
| 106 |
|
|
| 107 |
|
|
| 108 |
5 |
Sequence[] seqs = new Sequence[5]; |
| 109 |
5 |
seqs[0] = new Sequence("FER_CAPAN", |
| 110 |
|
"SVSATMISTSFMPRKPAVTSL-KPIPNVGE--ALF", 3, 34); |
| 111 |
5 |
seqs[1] = new Sequence("FER1_SOLLC", |
| 112 |
|
"SISGTMISTSFLPRKPAVTSL-KAISNVGE--ALF", 3, 34); |
| 113 |
5 |
seqs[2] = new Sequence("Q93XJ9_SOLTU", |
| 114 |
|
"SISGTMISTSFLPRKPVVTSL-KAISNVGE--ALF", 3, 34); |
| 115 |
5 |
seqs[3] = new Sequence("FER1_PEA", |
| 116 |
|
"ALYGTAVSTSFLRTQPMPMSV-TTTKAFSN--GFL", 6, 37); |
| 117 |
5 |
seqs[4] = new Sequence("Q7XA98_TRIPR", |
| 118 |
|
"ALYGTAVSTSFMRRQPVPMSV-ATTTTTKAFPSGF", 6, 39); |
| 119 |
|
|
| 120 |
5 |
SequenceI hiddenSeq = new Sequence("FER_TOCH", |
| 121 |
|
"FILGTMISKSFLFRKPAVTSL-KAISNVGE--ALF", 3, 34); |
| 122 |
5 |
expectedHiddenSeqs[0] = hiddenSeq; |
| 123 |
|
|
| 124 |
|
|
| 125 |
5 |
SequenceFeature seqFeature2 = new SequenceFeature("feature_x", |
| 126 |
|
"theDesc", 6, 15, "Jalview"); |
| 127 |
5 |
SequenceFeature seqFeature3 = new SequenceFeature("feature_x", |
| 128 |
|
"theDesc", 9, 18, "Jalview"); |
| 129 |
5 |
SequenceFeature seqFeature4 = new SequenceFeature("feature_x", |
| 130 |
|
"theDesc", 9, 18, "Jalview"); |
| 131 |
|
|
| 132 |
5 |
SequenceFeature seqFeature5 = new SequenceFeature("Domain", |
| 133 |
|
"My description", 0, 0, "Pfam"); |
| 134 |
5 |
seqs[2].addSequenceFeature(seqFeature2); |
| 135 |
5 |
seqs[3].addSequenceFeature(seqFeature3); |
| 136 |
5 |
seqs[4].addSequenceFeature(seqFeature4); |
| 137 |
5 |
seqs[2].addSequenceFeature(seqFeature5); |
| 138 |
|
|
| 139 |
5 |
for (Sequence seq : seqs) |
| 140 |
|
{ |
| 141 |
25 |
seq.createDatasetSequence(); |
| 142 |
25 |
expectedSeqs.put(seq.getName(), seq); |
| 143 |
|
} |
| 144 |
|
|
| 145 |
|
|
| 146 |
5 |
List<SequenceI> grpSeqs = new ArrayList<>(); |
| 147 |
5 |
grpSeqs.add(seqs[1]); |
| 148 |
5 |
grpSeqs.add(seqs[2]); |
| 149 |
5 |
grpSeqs.add(seqs[3]); |
| 150 |
5 |
grpSeqs.add(seqs[4]); |
| 151 |
5 |
SequenceGroup seqGrp = new SequenceGroup(grpSeqs, "JGroup:1883305585", |
| 152 |
|
null, true, true, false, 21, 29); |
| 153 |
5 |
ColourSchemeI scheme = ColourSchemeMapper |
| 154 |
|
.getJalviewColourScheme("zappo", seqGrp); |
| 155 |
5 |
seqGrp.cs.setColourScheme(scheme); |
| 156 |
5 |
seqGrp.setShowNonconserved(false); |
| 157 |
5 |
seqGrp.setDescription(null); |
| 158 |
|
|
| 159 |
5 |
expectedGrps.put(seqGrp.getName(), seqGrp); |
| 160 |
|
|
| 161 |
|
|
| 162 |
5 |
Annotation[] annot = new Annotation[35]; |
| 163 |
5 |
annot[0] = new Annotation("", "", '\u0000', 0); |
| 164 |
5 |
annot[1] = new Annotation("", "", '\u0000', 0); |
| 165 |
5 |
annot[2] = new Annotation("α", "", 'H', 0); |
| 166 |
5 |
annot[3] = new Annotation("α", "", 'H', 0); |
| 167 |
5 |
annot[4] = new Annotation("α", "", 'H', 0); |
| 168 |
5 |
annot[5] = new Annotation("", "", '\u0000', 0); |
| 169 |
5 |
annot[6] = new Annotation("", "", '\u0000', 0); |
| 170 |
5 |
annot[7] = new Annotation("", "", '\u0000', 0); |
| 171 |
5 |
annot[8] = new Annotation("β", "", 'E', 0); |
| 172 |
5 |
annot[9] = new Annotation("β", "", 'E', 0); |
| 173 |
5 |
annot[10] = new Annotation("β", "", 'E', 0); |
| 174 |
5 |
annot[11] = new Annotation("β", "", 'E', 0); |
| 175 |
5 |
annot[12] = new Annotation("β", "", 'E', 0); |
| 176 |
5 |
annot[13] = new Annotation("β", "", 'E', 0); |
| 177 |
5 |
annot[14] = new Annotation("β", "", 'E', 0); |
| 178 |
5 |
annot[15] = new Annotation("β", "", 'E', 0); |
| 179 |
5 |
annot[16] = new Annotation("", "", '\u0000', 0); |
| 180 |
5 |
annot[17] = new Annotation("", "", '\u0000', 0); |
| 181 |
5 |
annot[18] = new Annotation("", "", '\u0000', 0); |
| 182 |
5 |
annot[19] = new Annotation("", "", '\u0000', 0); |
| 183 |
5 |
annot[20] = new Annotation("", "", '\u0000', 0); |
| 184 |
5 |
annot[21] = new Annotation("", "", '\u0000', 0); |
| 185 |
5 |
annot[22] = new Annotation("", "", '\u0000', 0); |
| 186 |
5 |
annot[23] = new Annotation("", "", '\u0000', 0); |
| 187 |
5 |
annot[24] = new Annotation("", "", '\u0000', 0); |
| 188 |
5 |
annot[25] = new Annotation("", "", '\u0000', 0); |
| 189 |
5 |
annot[26] = new Annotation("α", "", 'H', 0); |
| 190 |
5 |
annot[27] = new Annotation("α", "", 'H', 0); |
| 191 |
5 |
annot[28] = new Annotation("α", "", 'H', 0); |
| 192 |
5 |
annot[29] = new Annotation("α", "", 'H', 0); |
| 193 |
5 |
annot[30] = new Annotation("α", "", 'H', 0); |
| 194 |
5 |
annot[31] = new Annotation("", "", '\u0000', 0); |
| 195 |
5 |
annot[32] = new Annotation("", "", '\u0000', 0); |
| 196 |
5 |
annot[33] = new Annotation("", "", '\u0000', 0); |
| 197 |
5 |
annot[34] = new Annotation("", "", '\u0000', 0); |
| 198 |
|
|
| 199 |
5 |
AlignmentAnnotation alignAnnot = new AlignmentAnnotation( |
| 200 |
|
"Secondary Structure", "New description", annot); |
| 201 |
5 |
expectedAnnots.put(alignAnnot.label, alignAnnot); |
| 202 |
|
|
| 203 |
5 |
expectedColSel.hideColumns(32, 33); |
| 204 |
5 |
expectedColSel.hideColumns(34, 34); |
| 205 |
|
|
| 206 |
5 |
TEST_SEQ_HEIGHT = expectedSeqs.size(); |
| 207 |
5 |
TEST_GRP_HEIGHT = expectedGrps.size(); |
| 208 |
5 |
TEST_ANOT_HEIGHT = expectedAnnots.size(); |
| 209 |
5 |
TEST_CS_HEIGHT = expectedColSel.getNumberOfRegions(); |
| 210 |
|
|
| 211 |
5 |
exportSettings = new AlignExportSettingsAdapter(true); |
| 212 |
|
|
| 213 |
5 |
AppletFormatAdapter formatAdapter = new AppletFormatAdapter(); |
| 214 |
5 |
try |
| 215 |
|
{ |
| 216 |
5 |
alignment = (Alignment) formatAdapter.readFile(TEST_JSON_FILE, |
| 217 |
|
DataSourceType.FILE, FileFormat.Json); |
| 218 |
5 |
jf = (JSONFile) formatAdapter.getAlignFile(); |
| 219 |
|
|
| 220 |
5 |
AlignFrame af = new AlignFrame(alignment, jf.getHiddenSequences(), |
| 221 |
|
jf.getHiddenColumns(), AlignFrame.DEFAULT_WIDTH, |
| 222 |
|
AlignFrame.DEFAULT_HEIGHT); |
| 223 |
5 |
af.getViewport().setShowSequenceFeatures(jf.isShowSeqFeatures()); |
| 224 |
5 |
String colourSchemeName = jf.getGlobalColourScheme(); |
| 225 |
5 |
ColourSchemeI cs = ColourSchemeMapper |
| 226 |
|
.getJalviewColourScheme(colourSchemeName, alignment); |
| 227 |
5 |
af.changeColour(cs); |
| 228 |
5 |
af.getViewport().setFeaturesDisplayed(jf.getDisplayedFeatures()); |
| 229 |
|
|
| 230 |
5 |
formatAdapter = new AppletFormatAdapter(af.alignPanel, |
| 231 |
|
exportSettings); |
| 232 |
5 |
String jsonOutput = formatAdapter.formatSequences(FileFormat.Json, |
| 233 |
|
af.alignPanel.getAlignment(), false); |
| 234 |
|
|
| 235 |
5 |
formatAdapter = new AppletFormatAdapter(); |
| 236 |
5 |
testAlignment = formatAdapter.readFile(jsonOutput, |
| 237 |
|
DataSourceType.PASTE, FileFormat.Json); |
| 238 |
5 |
testJsonFile = (JSONFile) formatAdapter.getAlignFile(); |
| 239 |
5 |
System.out.println(jsonOutput); |
| 240 |
|
} catch (IOException e) |
| 241 |
|
{ |
| 242 |
0 |
e.printStackTrace(); |
| 243 |
|
} |
| 244 |
|
|
| 245 |
|
} |
| 246 |
|
|
| |
|
| 100% |
Uncovered Elements: 0 (1) |
Complexity: 1 |
Complexity Density: 1 |
|
| 247 |
10 |
@BeforeMethod(alwaysRun = true)... |
| 248 |
|
public void methodSetup() |
| 249 |
|
{ |
| 250 |
10 |
passedCount = 0; |
| 251 |
|
} |
| 252 |
|
|
| |
|
| 100% |
Uncovered Elements: 0 (7) |
Complexity: 1 |
Complexity Density: 0.14 |
|
| 253 |
4 |
@AfterTest(alwaysRun = true)... |
| 254 |
|
public void tearDown() throws Exception |
| 255 |
|
{ |
| 256 |
4 |
testJsonFile = null; |
| 257 |
4 |
alignment = null; |
| 258 |
4 |
expectedSeqs = null; |
| 259 |
4 |
expectedAnnots = null; |
| 260 |
4 |
expectedGrps = null; |
| 261 |
4 |
testAlignment = null; |
| 262 |
4 |
jf = null; |
| 263 |
|
} |
| 264 |
|
|
| |
|
| 100% |
Uncovered Elements: 0 (1) |
Complexity: 1 |
Complexity Density: 1 |
1PASS
|
|
| 265 |
1 |
@Test(groups = { "Functional" })... |
| 266 |
|
public void roundTripTest() |
| 267 |
|
{ |
| 268 |
1 |
assertNotNull("JSON roundtrip test failed!", testJsonFile); |
| 269 |
|
} |
| 270 |
|
|
| |
|
| 100% |
Uncovered Elements: 0 (7) |
Complexity: 1 |
Complexity Density: 0.14 |
1PASS
|
|
| 271 |
1 |
@Test(groups = { "Functional" })... |
| 272 |
|
public void testSeqParsed() |
| 273 |
|
{ |
| 274 |
1 |
assertNotNull("Couldn't read supplied alignment data.", testAlignment); |
| 275 |
1 |
Assert.assertNotNull(testAlignment.getSequences()); |
| 276 |
1 |
for (SequenceI seq : testAlignment.getSequences()) |
| 277 |
|
{ |
| 278 |
5 |
SequenceI expectedSeq = expectedSeqs.get(seq.getName()); |
| 279 |
5 |
AssertJUnit.assertTrue( |
| 280 |
|
"Failed Sequence Test for >>> " + seq.getName(), |
| 281 |
|
isSeqMatched(expectedSeq, seq)); |
| 282 |
5 |
passedCount++; |
| 283 |
|
} |
| 284 |
1 |
AssertJUnit.assertEquals("Some Sequences did not pass the test", |
| 285 |
|
TEST_SEQ_HEIGHT, passedCount); |
| 286 |
|
} |
| 287 |
|
|
| |
|
| 100% |
Uncovered Elements: 0 (7) |
Complexity: 1 |
Complexity Density: 0.14 |
1PASS
|
|
| 288 |
1 |
@Test(groups = { "Functional" })... |
| 289 |
|
public void hiddenColsTest() |
| 290 |
|
{ |
| 291 |
1 |
HiddenColumns cs = testJsonFile.getHiddenColumns(); |
| 292 |
1 |
Assert.assertNotNull(cs); |
| 293 |
|
|
| 294 |
1 |
Iterator<int[]> it = cs.iterator(); |
| 295 |
1 |
Iterator<int[]> colselit = expectedColSel.iterator(); |
| 296 |
1 |
Assert.assertTrue(it.hasNext()); |
| 297 |
1 |
Assert.assertEquals(cs.getNumberOfRegions(), TEST_CS_HEIGHT); |
| 298 |
1 |
Assert.assertEquals(it.next(), colselit.next(), |
| 299 |
|
"Mismatched hidden columns!"); |
| 300 |
|
} |
| 301 |
|
|
| |
|
| 100% |
Uncovered Elements: 0 (2) |
Complexity: 1 |
Complexity Density: 0.5 |
1PASS
|
|
| 302 |
1 |
@Test(groups = { "Functional" })... |
| 303 |
|
public void hiddenSeqsTest() |
| 304 |
|
{ |
| 305 |
1 |
Assert.assertNotNull(testJsonFile.getHiddenSequences(), |
| 306 |
|
"Hidden sequence Expected but found Null"); |
| 307 |
1 |
Assert.assertEquals(jf.getHiddenSequences().length, 1, |
| 308 |
|
"Hidden sequence"); |
| 309 |
|
} |
| 310 |
|
|
| |
|
| 100% |
Uncovered Elements: 0 (2) |
Complexity: 1 |
Complexity Density: 0.5 |
1PASS
|
|
| 311 |
1 |
@Test(groups = { "Functional" })... |
| 312 |
|
public void colorSchemeTest() |
| 313 |
|
{ |
| 314 |
1 |
Assert.assertNotNull(testJsonFile.getGlobalColourScheme(), |
| 315 |
|
"Colourscheme is null, parsing failed!"); |
| 316 |
1 |
Assert.assertEquals(testJsonFile.getGlobalColourScheme(), "Zappo", |
| 317 |
|
"Zappo colour scheme expected!"); |
| 318 |
|
} |
| 319 |
|
|
| 320 |
|
|
| 321 |
|
|
| 322 |
|
|
| 323 |
|
|
| |
|
| 94.7% |
Uncovered Elements: 1 (19) |
Complexity: 2 |
Complexity Density: 0.11 |
1PASS
|
|
| 324 |
1 |
@Test(groups = { "Functional" })... |
| 325 |
|
public void testBioJSONRoundTripWithColourSchemeNone() |
| 326 |
|
{ |
| 327 |
1 |
AppletFormatAdapter formatAdapter = new AppletFormatAdapter(); |
| 328 |
|
|
| 329 |
1 |
Alignment _alignment; |
| 330 |
1 |
try |
| 331 |
|
{ |
| 332 |
|
|
| 333 |
1 |
_alignment = (Alignment) formatAdapter.readFile(TEST_JSON_FILE, |
| 334 |
|
DataSourceType.FILE, FileFormat.Json); |
| 335 |
1 |
JSONFile bioJsonFile = (JSONFile) formatAdapter.getAlignFile(); |
| 336 |
1 |
AlignFrame alignFrame = new AlignFrame(_alignment, |
| 337 |
|
bioJsonFile.getHiddenSequences(), |
| 338 |
|
bioJsonFile.getHiddenColumns(), AlignFrame.DEFAULT_WIDTH, |
| 339 |
|
AlignFrame.DEFAULT_HEIGHT); |
| 340 |
|
|
| 341 |
|
|
| 342 |
|
|
| 343 |
|
|
| 344 |
|
|
| 345 |
1 |
SequenceGroup sg = new SequenceGroup(); |
| 346 |
1 |
sg.addSequence(_alignment.getSequenceAt(0), false); |
| 347 |
1 |
sg.setColourScheme(null); |
| 348 |
1 |
ColourSchemeI cs = ColourSchemeMapper |
| 349 |
|
.getJalviewColourScheme(ResidueColourScheme.NONE, _alignment); |
| 350 |
1 |
alignFrame.changeColour(cs); |
| 351 |
1 |
alignFrame.getViewport() |
| 352 |
|
.setFeaturesDisplayed(bioJsonFile.getDisplayedFeatures()); |
| 353 |
1 |
formatAdapter = new AppletFormatAdapter(alignFrame.alignPanel, |
| 354 |
|
exportSettings); |
| 355 |
|
|
| 356 |
1 |
String jsonOutput = formatAdapter.formatSequences(FileFormat.Json, |
| 357 |
|
alignFrame.alignPanel.getAlignment(), false); |
| 358 |
|
|
| 359 |
1 |
formatAdapter = new AppletFormatAdapter(); |
| 360 |
1 |
formatAdapter.readFile(jsonOutput, DataSourceType.PASTE, |
| 361 |
|
FileFormat.Json); |
| 362 |
|
|
| 363 |
1 |
JSONFile _bioJsonFile = (JSONFile) formatAdapter.getAlignFile(); |
| 364 |
1 |
Assert.assertEquals(_bioJsonFile.getGlobalColourScheme(), |
| 365 |
|
ResidueColourScheme.NONE); |
| 366 |
|
} catch (IOException e) |
| 367 |
|
{ |
| 368 |
0 |
e.printStackTrace(); |
| 369 |
|
} |
| 370 |
|
} |
| 371 |
|
|
| |
|
| 100% |
Uncovered Elements: 0 (1) |
Complexity: 1 |
Complexity Density: 1 |
1PASS
|
|
| 372 |
1 |
@Test(groups = { "Functional" })... |
| 373 |
|
public void isShowSeqFeaturesSet() |
| 374 |
|
{ |
| 375 |
1 |
Assert.assertTrue(testJsonFile.isShowSeqFeatures(), |
| 376 |
|
"Sequence feature isDisplayed setting expected to be true"); |
| 377 |
|
} |
| 378 |
|
|
| |
|
| 100% |
Uncovered Elements: 0 (6) |
Complexity: 1 |
Complexity Density: 0.17 |
1PASS
|
|
| 379 |
1 |
@Test(groups = { "Functional" })... |
| 380 |
|
public void testGrpParsed() |
| 381 |
|
{ |
| 382 |
1 |
Assert.assertNotNull(testAlignment.getGroups()); |
| 383 |
1 |
for (SequenceGroup seqGrp : testAlignment.getGroups()) |
| 384 |
|
{ |
| 385 |
1 |
SequenceGroup expectedGrp = expectedGrps.get(seqGrp.getName()); |
| 386 |
1 |
AssertJUnit.assertTrue( |
| 387 |
|
"Failed SequenceGroup Test for >>> " + seqGrp.getName(), |
| 388 |
|
isGroupMatched(expectedGrp, seqGrp)); |
| 389 |
1 |
passedCount++; |
| 390 |
|
} |
| 391 |
1 |
AssertJUnit.assertEquals("Some SequenceGroups did not pass the test", |
| 392 |
|
TEST_GRP_HEIGHT, passedCount); |
| 393 |
|
} |
| 394 |
|
|
| |
|
| 100% |
Uncovered Elements: 0 (6) |
Complexity: 1 |
Complexity Density: 0.17 |
1PASS
|
|
| 395 |
1 |
@Test(groups = { "Functional" })... |
| 396 |
|
public void testAnnotationParsed() |
| 397 |
|
{ |
| 398 |
1 |
Assert.assertNotNull(testAlignment.getAlignmentAnnotation()); |
| 399 |
1 |
for (AlignmentAnnotation annot : testAlignment.getAlignmentAnnotation()) |
| 400 |
|
{ |
| 401 |
1 |
AlignmentAnnotation expectedAnnot = expectedAnnots.get(annot.label); |
| 402 |
1 |
AssertJUnit.assertTrue( |
| 403 |
|
"Failed AlignmentAnnotation Test for >>> " + annot.label, |
| 404 |
|
isAnnotationMatched(expectedAnnot, annot)); |
| 405 |
1 |
passedCount++; |
| 406 |
|
} |
| 407 |
1 |
AssertJUnit.assertEquals("Some Sequences did not pass the test", |
| 408 |
|
TEST_ANOT_HEIGHT, passedCount); |
| 409 |
|
} |
| 410 |
|
|
| |
|
| 71.4% |
Uncovered Elements: 4 (14) |
Complexity: 8 |
Complexity Density: 1 |
|
| 411 |
1 |
public boolean isAnnotationMatched(AlignmentAnnotation eAnnot,... |
| 412 |
|
AlignmentAnnotation annot) |
| 413 |
|
{ |
| 414 |
1 |
if (!eAnnot.label.equals(annot.label) |
| 415 |
|
|| !eAnnot.description.equals(annot.description) |
| 416 |
|
|| eAnnot.annotations.length != annot.annotations.length) |
| 417 |
|
{ |
| 418 |
0 |
return false; |
| 419 |
|
} |
| 420 |
|
|
| 421 |
36 |
for (int x = 0; x < annot.annotations.length; x++) |
| 422 |
|
{ |
| 423 |
35 |
Annotation y = annot.annotations[x]; |
| 424 |
35 |
Annotation z = annot.annotations[x]; |
| 425 |
|
|
| 426 |
35 |
if (!y.displayCharacter.equals(z.displayCharacter) |
| 427 |
|
|| y.value != z.value |
| 428 |
|
|| y.secondaryStructure != z.secondaryStructure) |
| 429 |
|
{ |
| 430 |
0 |
return false; |
| 431 |
|
} |
| 432 |
|
} |
| 433 |
1 |
return true; |
| 434 |
|
} |
| 435 |
|
|
| |
|
| 66.7% |
Uncovered Elements: 2 (6) |
Complexity: 6 |
Complexity Density: 1.5 |
|
| 436 |
5 |
boolean isSeqMatched(SequenceI expectedSeq, SequenceI actualSeq)... |
| 437 |
|
{ |
| 438 |
5 |
System.out.println("Testing >>> " + actualSeq.getName()); |
| 439 |
|
|
| 440 |
5 |
if (expectedSeq.getName().equals(actualSeq.getName()) |
| 441 |
|
&& expectedSeq.getSequenceAsString() |
| 442 |
|
.equals(actualSeq.getSequenceAsString()) |
| 443 |
|
&& expectedSeq.getStart() == actualSeq.getStart() |
| 444 |
|
&& expectedSeq.getEnd() == actualSeq.getEnd() |
| 445 |
|
&& featuresMatched(expectedSeq, actualSeq)) |
| 446 |
|
{ |
| 447 |
5 |
return true; |
| 448 |
|
} |
| 449 |
0 |
return false; |
| 450 |
|
} |
| 451 |
|
|
| |
|
| 86.7% |
Uncovered Elements: 2 (15) |
Complexity: 9 |
Complexity Density: 0.69 |
|
| 452 |
2 |
public boolean isGroupMatched(SequenceGroup expectedGrp,... |
| 453 |
|
SequenceGroup actualGrp) |
| 454 |
|
{ |
| 455 |
|
|
| 456 |
2 |
System.out.println("Testing >>> " + actualGrp.getName()); |
| 457 |
2 |
System.out.println(expectedGrp.getName() + " | " + actualGrp.getName()); |
| 458 |
2 |
System.out.println(expectedGrp.getColourText() + " | " |
| 459 |
|
+ actualGrp.getColourText()); |
| 460 |
2 |
System.out.println(expectedGrp.getDisplayBoxes() + " | " |
| 461 |
|
+ actualGrp.getDisplayBoxes()); |
| 462 |
2 |
System.out.println(expectedGrp.getIgnoreGapsConsensus() + " | " |
| 463 |
|
+ actualGrp.getIgnoreGapsConsensus()); |
| 464 |
2 |
System.out.println(expectedGrp.getSequences().size() + " | " |
| 465 |
|
+ actualGrp.getSequences().size()); |
| 466 |
2 |
System.out.println( |
| 467 |
|
expectedGrp.getStartRes() + " | " + actualGrp.getStartRes()); |
| 468 |
2 |
System.out.println( |
| 469 |
|
expectedGrp.getEndRes() + " | " + actualGrp.getEndRes()); |
| 470 |
2 |
System.out.println(expectedGrp.cs.getColourScheme() + " | " |
| 471 |
|
+ actualGrp.cs.getColourScheme()); |
| 472 |
|
|
| 473 |
2 |
boolean colourSchemeMatches = (expectedGrp.cs.getColourScheme() == null |
| 474 |
|
&& actualGrp.cs.getColourScheme() == null) |
| 475 |
|
|| expectedGrp.cs.getColourScheme().getClass() |
| 476 |
|
.equals(actualGrp.cs.getColourScheme().getClass()); |
| 477 |
2 |
if (expectedGrp.getName().equals(actualGrp.getName()) |
| 478 |
|
&& expectedGrp.getColourText() == actualGrp.getColourText() |
| 479 |
|
&& expectedGrp.getDisplayBoxes() == actualGrp.getDisplayBoxes() |
| 480 |
|
&& expectedGrp.getIgnoreGapsConsensus() == actualGrp |
| 481 |
|
.getIgnoreGapsConsensus() |
| 482 |
|
&& colourSchemeMatches |
| 483 |
|
&& expectedGrp.getSequences().size() == actualGrp.getSequences() |
| 484 |
|
.size() |
| 485 |
|
&& expectedGrp.getStartRes() == actualGrp.getStartRes() |
| 486 |
|
&& expectedGrp.getEndRes() == actualGrp.getEndRes()) |
| 487 |
|
{ |
| 488 |
2 |
return true; |
| 489 |
|
} |
| 490 |
0 |
return false; |
| 491 |
|
} |
| 492 |
|
|
| |
|
| 64% |
Uncovered Elements: 9 (25) |
Complexity: 6 |
Complexity Density: 0.32 |
|
| 493 |
5 |
private boolean featuresMatched(SequenceI seq1, SequenceI seq2)... |
| 494 |
|
{ |
| 495 |
5 |
try |
| 496 |
|
{ |
| 497 |
5 |
if (seq1 == null && seq2 == null) |
| 498 |
|
{ |
| 499 |
0 |
return true; |
| 500 |
|
} |
| 501 |
|
|
| 502 |
5 |
List<SequenceFeature> inFeature = seq1.getFeatures().getAllFeatures(); |
| 503 |
5 |
List<SequenceFeature> outFeature = seq2.getFeatures() |
| 504 |
|
.getAllFeatures(); |
| 505 |
|
|
| 506 |
5 |
if (inFeature.size() != outFeature.size()) |
| 507 |
|
{ |
| 508 |
0 |
System.err.println("Feature count in: " + inFeature.size() |
| 509 |
|
+ ", out: " + outFeature.size()); |
| 510 |
0 |
return false; |
| 511 |
|
} |
| 512 |
|
|
| 513 |
5 |
SequenceFeatures.sortFeatures(inFeature, true); |
| 514 |
5 |
SequenceFeatures.sortFeatures(outFeature, true); |
| 515 |
5 |
int i = 0; |
| 516 |
5 |
for (SequenceFeature in : inFeature) |
| 517 |
|
{ |
| 518 |
4 |
SequenceFeature out = outFeature.get(i); |
| 519 |
|
|
| 520 |
|
|
| 521 |
|
|
| 522 |
|
|
| 523 |
|
|
| 524 |
4 |
if (!in.equals(out)) |
| 525 |
|
{ |
| 526 |
0 |
System.err.println( |
| 527 |
|
"Mismatch of " + in.toString() + " " + out.toString()); |
| 528 |
0 |
return false; |
| 529 |
|
} |
| 530 |
|
|
| 531 |
|
|
| 532 |
|
|
| 533 |
|
|
| 534 |
|
|
| 535 |
|
|
| 536 |
|
|
| 537 |
|
|
| 538 |
|
|
| 539 |
|
|
| 540 |
|
|
| 541 |
|
|
| 542 |
|
|
| 543 |
|
|
| 544 |
|
|
| 545 |
|
|
| 546 |
4 |
i++; |
| 547 |
|
} |
| 548 |
|
} catch (Exception e) |
| 549 |
|
{ |
| 550 |
0 |
e.printStackTrace(); |
| 551 |
|
} |
| 552 |
|
|
| 553 |
5 |
return true; |
| 554 |
|
} |
| 555 |
|
|
| |
|
| 0% |
Uncovered Elements: 26 (26) |
Complexity: 12 |
Complexity Density: 0.75 |
|
| 556 |
0 |
boolean mapsMatch(Map<String, Object> m1, Map<String, Object> m2)... |
| 557 |
|
{ |
| 558 |
0 |
if (m1 == null || m2 == null) |
| 559 |
|
{ |
| 560 |
0 |
if (m1 != null || m2 != null) |
| 561 |
|
{ |
| 562 |
0 |
System.err.println( |
| 563 |
|
"only one SequenceFeature.otherDetails is not null"); |
| 564 |
0 |
return false; |
| 565 |
|
} |
| 566 |
|
else |
| 567 |
|
{ |
| 568 |
0 |
return true; |
| 569 |
|
} |
| 570 |
|
} |
| 571 |
0 |
if (m1.size() != m2.size()) |
| 572 |
|
{ |
| 573 |
0 |
System.err.println("otherDetails map different sizes"); |
| 574 |
0 |
return false; |
| 575 |
|
} |
| 576 |
0 |
for (String key : m1.keySet()) |
| 577 |
|
{ |
| 578 |
0 |
if (!m2.containsKey(key)) |
| 579 |
|
{ |
| 580 |
0 |
System.err.println(key + " in only one otherDetails"); |
| 581 |
0 |
return false; |
| 582 |
|
} |
| 583 |
0 |
if (m1.get(key) == null && m2.get(key) != null |
| 584 |
|
|| m1.get(key) != null && m2.get(key) == null |
| 585 |
|
|| !m1.get(key).equals(m2.get(key))) |
| 586 |
|
{ |
| 587 |
0 |
System.err.println(key + " values in otherDetails don't match"); |
| 588 |
0 |
return false; |
| 589 |
|
} |
| 590 |
|
} |
| 591 |
0 |
return true; |
| 592 |
|
} |
| 593 |
|
|
| 594 |
|
|
| 595 |
|
|
| 596 |
|
|
| 597 |
|
@throws |
| 598 |
|
|
| |
|
| 100% |
Uncovered Elements: 0 (18) |
Complexity: 1 |
Complexity Density: 0.06 |
1PASS
|
|
| 599 |
1 |
@Test(groups = { "Functional" })... |
| 600 |
|
public void testGrpParsed_colourNone() throws IOException |
| 601 |
|
{ |
| 602 |
1 |
AlignmentI copy = new Alignment(testAlignment); |
| 603 |
1 |
SequenceGroup sg = testAlignment.getGroups().get(0); |
| 604 |
1 |
SequenceGroup copySg = new SequenceGroup(new ArrayList<SequenceI>(), |
| 605 |
|
sg.getName(), null, sg.getDisplayBoxes(), sg.getDisplayText(), |
| 606 |
|
sg.getColourText(), sg.getStartRes(), sg.getEndRes()); |
| 607 |
1 |
for (SequenceI seq : sg.getSequences()) |
| 608 |
|
{ |
| 609 |
4 |
int seqIndex = testAlignment.findIndex(seq); |
| 610 |
4 |
copySg.addSequence(copy.getSequenceAt(seqIndex), false); |
| 611 |
|
} |
| 612 |
1 |
copy.addGroup(copySg); |
| 613 |
|
|
| 614 |
1 |
AlignFrame af = new AlignFrame(copy, copy.getWidth(), copy.getHeight()); |
| 615 |
1 |
AppletFormatAdapter formatAdapter = new AppletFormatAdapter( |
| 616 |
|
af.alignPanel); |
| 617 |
1 |
String jsonOutput = formatAdapter.formatSequences(FileFormat.Json, copy, |
| 618 |
|
false); |
| 619 |
1 |
formatAdapter = new AppletFormatAdapter(); |
| 620 |
1 |
AlignmentI newAlignment = formatAdapter.readFile(jsonOutput, |
| 621 |
|
DataSourceType.PASTE, FileFormat.Json); |
| 622 |
|
|
| 623 |
1 |
Assert.assertNotNull(newAlignment.getGroups()); |
| 624 |
1 |
for (SequenceGroup seqGrp : newAlignment.getGroups()) |
| 625 |
|
{ |
| 626 |
1 |
SequenceGroup expectedGrp = copySg; |
| 627 |
1 |
AssertJUnit.assertTrue( |
| 628 |
|
"Failed SequenceGroup Test for >>> " + seqGrp.getName(), |
| 629 |
|
isGroupMatched(expectedGrp, seqGrp)); |
| 630 |
1 |
passedCount++; |
| 631 |
|
} |
| 632 |
1 |
AssertJUnit.assertEquals("Some SequenceGroups did not pass the test", |
| 633 |
|
TEST_GRP_HEIGHT, passedCount); |
| 634 |
|
} |
| 635 |
|
} |